Structure of PDB 7onu Chain F Binding Site BS01

Receptor Information
>7onu Chain F (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEK
VKKARQIKKEMKAAAKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDM
AYENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELV
KRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTADSPNVMTTFRHDKVYVI
GSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKNLTLDQMIRI
LLCLKNNGNWQEALQFVPKRKHTGFL
Ligand information
>7onu Chain T (length=66) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagguaaaauggcugagaagcauuggacuguaaaucuaaagacagggguu
aggccucuuuuuacca
..<<<<<<<..<<<....>>>.<<<<<.......>>>>>....<<<<<..
...>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7onu Structural basis of RNA processing by human mitochondrial RNase P.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S125 T127 K131 Y135 K141 V142 K143 R146 K149 F177 R181 L182 D184 R185 K218 N222 Q226 E229 R235 R236 R261 V313 K315 M317 W344 E345 N348 K349 T352 D354 Q355 P377 K378 R379
Binding residue
(residue number reindexed from 1)		S34 T36 K40 Y44 K50 V51 K52 R55 K58 F68 R72 L73 D75 R76 K109 N113 Q117 E120 R126 R127 R152 V204 K206 M208 W235 E236 N239 K240 T243 D245 Q246 P268 K269 R270
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.218: tRNA (adenine(9)-N(1))-methyltransferase.
2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0042802 identical protein binding
GO:0052905 tRNA (guanosine(9)-N1)-methyltransferase activity
GO:0160106 tRNA (adenine(9)-N1)-methyltransferase activity
Biological Process
GO:0000964 mitochondrial RNA 5'-end processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0032259 methylation
GO:0070131 positive regulation of mitochondrial translation
GO:0070901 mitochondrial tRNA methylation
GO:0090646 mitochondrial tRNA processing
GO:0097745 mitochondrial tRNA 5'-end processing
GO:1990180 mitochondrial tRNA 3'-end processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0030678 mitochondrial ribonuclease P complex
GO:0042645 mitochondrial nucleoid
GO:0043527 tRNA methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7onu, PDBe:7onu, PDBj:7onu
PDBsum7onu
PubMed34489609
UniProtQ7L0Y3|TM10C_HUMAN tRNA methyltransferase 10 homolog C (Gene Name=TRMT10C)

[Back to BioLiP]