Structure of PDB 7n5v Chain F Binding Site BS01

Receptor Information
>7n5v Chain F (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVH
MRKHTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n5v Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		E407 K408 R418
Binding residue
(residue number reindexed from 1)		E29 K30 R40
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7n5v, PDBe:7n5v, PDBj:7n5v
PDBsum7n5v
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]