Structure of PDB 7n4e Chain F Binding Site BS01

Receptor Information
>7n4e Chain F (length=359) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPE
AITYLLEQYDRVEAEEARLSDLITGFELAREKFAELRAQYVVTRDTIKAH
ATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCV
EQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQ
KLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAK
KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRS
IADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPED
KIRKVLKIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n4e Structural and mechanistic basis of sigma-dependent transcriptional pausing.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		V98 M102 G106 L110 R385 K392 E420 R423 Y425 K426 T429 T432 W433 W434 Q437 R451 P453 H455
Binding residue
(residue number reindexed from 1)		V9 M13 G17 L21 R243 K250 E278 R281 Y283 K284 T287 T290 W291 W292 Q295 R309 P311 H313
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009408 response to heat
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n4e, PDBe:7n4e, PDBj:7n4e
PDBsum7n4e
PubMed35653571
UniProtP00579|RPOD_ECOLI RNA polymerase sigma factor RpoD (Gene Name=rpoD)

[Back to BioLiP]