Structure of PDB 7m78 Chain F Binding Site BS01

Receptor Information
>7m78 Chain F (length=141) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR
Ligand information
>7m78 Chain X (length=29) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTYAFRTFWAVLLLAINFLVAAYYFGILK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m78 Room temperature XFEL crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem I.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D54 G55
Binding residue
(residue number reindexed from 1)		D54 G55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m78, PDBe:7m78, PDBj:7m78
PDBsum7m78
PubMed34750381
UniProtP0A401|PSAF_THEVB Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]