Structure of PDB 7m1x Chain F Binding Site BS01

Receptor Information
>7m1x Chain F (length=86) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVI
RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>7m1x Chain I (length=136) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m1x Structural basis of chromatin regulation by histone variant H2A.Z.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R235 R245 I246 S247 G248 R278 K279 T280
Binding residue
(residue number reindexed from 1)		R19 R29 I30 S31 G32 R62 K63 T64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m1x, PDBe:7m1x, PDBj:7m1x
PDBsum7m1x
PubMed34643712
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]