Structure of PDB 7ktx Chain F Binding Site BS01

Receptor Information
>7ktx Chain F (length=97) Species: 1266529 (Saccharomyces cerevisiae BY4743) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNL
INVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYAL
Ligand information
>7ktx Chain M (length=21) Species: 1266529 (Saccharomyces cerevisiae BY4743) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ktx Structural and mechanistic basis of the EMC-dependent biogenesis of distinct transmembrane clients.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		H82 F90
Binding residue
(residue number reindexed from 1)		H73 F81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0032977 membrane insertase activity
Biological Process
GO:0000045 autophagosome assembly
GO:0006644 phospholipid metabolic process
GO:0015914 phospholipid transport
GO:0034975 protein folding in endoplasmic reticulum
GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0072546 EMC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ktx, PDBe:7ktx, PDBj:7ktx
PDBsum7ktx
PubMed33236988
UniProtQ12431|EMC6_YEAST ER membrane protein complex subunit 6 (Gene Name=EMC6)

[Back to BioLiP]