Structure of PDB 7kin Chain F Binding Site BS01

Receptor Information
>7kin Chain F (length=317) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYAT
QLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRY
TGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMA
DQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKV
LEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQL
QSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKT
MSKLRHPSRSQVLRDYL
Ligand information
>7kin Chain O (length=54) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aatcggttgtggtcagctgctgccaccggttaacctccattctgctgcca
gcct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kin Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		R229 L232 L240 R301 L302 R330 D336 Y341 K342 S344 T345 Y346 W349 W350 Q353 R357 R367 H371 V498 T499
Binding residue
(residue number reindexed from 1)		R19 L22 L30 R91 L92 R120 D126 Y131 K132 S134 T135 Y136 W139 W140 Q143 R147 R157 H161 V288 T289
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kin, PDBe:7kin, PDBj:7kin
PDBsum7kin
PubMed34171296
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]