Structure of PDB 7kim Chain F Binding Site BS01

Receptor Information
>7kim Chain F (length=322) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEA
GLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVS
LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAI
TRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDI
TPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTL
LQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQ
IESKTMSKLRHPSRSQVLRDYL
Ligand information
>7kim Chain O (length=45) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggtcagaaaatcggttgtggtcagctgctgccaccggttaacctc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kim Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		P369 H371 V498 T499 R502
Binding residue
(residue number reindexed from 1)		P164 H166 V293 T294 R297
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kim, PDBe:7kim, PDBj:7kim
PDBsum7kim
PubMed34171296
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]