Structure of PDB 7f75 Chain F Binding Site BS01

Receptor Information

>7f75 Chain F (length=272) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPVRMYLKEIGRVNLLSAKEEIAYAQKIEEGDEESKRRLAEANLRLVVSI
AKRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAIT
RAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPTPEEIAEDMDLT
PEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPSDHAAYELL
KEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQI
EAKALRKLRHPSRSKRLKDFLE

Ligand information

>7f75 Chain J (length=59) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcattaaaatagcgtgaacgaatgggagatgcttataatgggagctgtc
acggatgca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7f75 Structural basis of transcription activation by the global regulator Spx.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	V102 R103 L106 A141 R144 R181 K185 S187 T188 Y189 Q196 R200 R210 T342 R345
Binding residue (residue number reindexed from 1)	V3 R4 L7 A42 R45 R82 K86 S88 T89 Y90 Q97 R101 R111 T243 R246

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f75, PDBe:7f75, PDBj:7f75
PDBsum	7f75
PubMed	34530448
UniProt	P06224\|SIGA_BACSU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]