Structure of PDB 7f0r Chain F Binding Site BS01

Receptor Information
>7f0r Chain F (length=278) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRALDATQLYLNEIGFSPLLTPEEEVHFARLAQKGDPAGRKRMIESNLRL
VVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIR
QTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTHKLDHEPSPEEIANL
LEKPVAEVKRMLGLNERVTSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQ
DDDLSESIDQWLTELTDKQREVVIRRFGLRGHESSTLEEVGQEIGLTRER
VRQIQVEALKRLREILEKNGLSSDALFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f0r Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
Resolution5.8 Å
Binding residue
(original residue number in PDB)		W153 R156 E160 T292 E305 R308
Binding residue
(residue number reindexed from 1)		W97 R100 E104 T236 E249 R252
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:0050921 positive regulation of chemotaxis
GO:1900034 regulation of cellular response to heat
GO:1900233 positive regulation of single-species biofilm formation on inanimate substrate
GO:1900377 negative regulation of secondary metabolite biosynthetic process
GO:1900407 regulation of cellular response to oxidative stress
GO:1901000 regulation of response to salt stress
GO:2000142 regulation of DNA-templated transcription initiation
GO:2000145 regulation of cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0r, PDBe:7f0r, PDBj:7f0r
PDBsum7f0r
PubMed35859063
UniProtP45684|RPOS_PSEAE RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]