Structure of PDB 7ea5 Chain F Binding Site BS01

Receptor Information
>7ea5 Chain F (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>7ea5 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ea5 Cryo-EM structure of SETD2/Set2 methyltransferase bound to a nucleosome containing oncohistone mutations.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 K79 T80
Binding residue
(residue number reindexed from 1)		R12 R22 I23 K56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin

View graph for
Molecular Function
External links
PDB RCSB:7ea5, PDBe:7ea5, PDBj:7ea5
PDBsum7ea5
PubMed33972509
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]