Structure of PDB 7dnf Chain F Binding Site BS01

Receptor Information
>7dnf Chain F (length=155) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILMANGADVNANDVYGITPLHLAAYMGHLEI
VEVLLKYGVDVNASDQFGNTPLHLAADDGHLEIVEVLLKHGTDVNATDTW
GSTPLHLAAHRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLA
EILQK
Ligand information
>7dnf Chain E (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTTPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dnf Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		E20 R23 Y46 I48 L53 Y56 M57
Binding residue
(residue number reindexed from 1)		E8 R11 Y34 I36 L41 Y44 M45
External links