Structure of PDB 7dct Chain F Binding Site BS01

Receptor Information
>7dct Chain F (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKH
NNMASFVRQLNMYGFRKVVDTEFQHPCFLRGQEQLLENIKRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dct Structures of heat shock factor trimers bound to DNA.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		F18 K62 H63 N65 S68 R71 Q72 Y76 R117
Binding residue
(residue number reindexed from 1)		F5 K49 H50 N52 S55 R58 Q59 Y63 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dct, PDBe:7dct, PDBj:7dct
PDBsum7dct
PubMed34458700
UniProtQ00613|HSF1_HUMAN Heat shock factor protein 1 (Gene Name=HSF1)

[Back to BioLiP]