Structure of PDB 7d7d Chain F Binding Site BS01

Receptor Information
>7d7d Chain F (length=137) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVNNKELLQAIIDWKTELANVRQNDTIGLAIMLIAEGLSKRFNFSGYTQS
WKQEMIADGIEASIKGLHNFDETKYKNPHAYITQACFNAFVQRIKKERKE
VAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMT
Ligand information
>7d7d Chain T (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggctgcttcagtatttatactctcagtaatagtgctgagctcttta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d7d Transcription activation by a sliding clamp.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		N59 Y63 T64 W67 N104 V107 K111 R114 Y121 L139
Binding residue
(residue number reindexed from 1)		N43 Y47 T48 W51 N88 V91 K95 R98 Y105 L123
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 13:59:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7d7d', asym_id = 'F', bs = 'BS01', title = 'Transcription activation by a sliding clamp.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7d7d', asym_id='F', bs='BS01', title='Transcription activation by a sliding clamp.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,2000142', uniprot = '', pdbid = '7d7d', asym_id = 'F'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,2000142', uniprot='', pdbid='7d7d', asym_id='F')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>