Structure of PDB 7cvq Chain F Binding Site BS01

Receptor Information
>7cvq Chain F (length=125) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNH
TEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPRMDREARVLRYREKRKTR
KFEKTIRYASRKAYAEIRPRVNGRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cvq Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		M88 I89 S90 K324 Y328 R331 K332 N342 G343 F345
Binding residue
(residue number reindexed from 1)		M23 I24 S25 K104 Y108 R111 K112 N122 G123 F125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7cvq, PDBe:7cvq, PDBj:7cvq
PDBsum7cvq
PubMed33693873
UniProtQ39057|CONS_ARATH Zinc finger protein CONSTANS (Gene Name=CO);
Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 (Gene Name=NFYC3)

[Back to BioLiP]