Structure of PDB 7cr8 Chain F Binding Site BS01

Receptor Information
>7cr8 Chain F (length=93) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLYLIIYDVPATKAGNKRRTRLFDLLSGYGKWRQFSVFECFLSVKQFAKL
QTAMEKLIKLDEDAVCIYVLDENTVQRTITYGTPQPEKPGSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cr8 Mechanisms of spacer acquisition by sequential assembly of the adaptation module in Synechocystis.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		K17 R21 F35
Binding residue
(residue number reindexed from 1)		K17 R21 F35
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7cr8, PDBe:7cr8, PDBj:7cr8
PDBsum7cr8
PubMed33619565
UniProtQ6ZEI1|CAS2A_SYNY3 CRISPR-associated endoribonuclease Cas2 1 (Gene Name=cas2-1)

[Back to BioLiP]