Structure of PDB 7ckq Chain F Binding Site BS01

Receptor Information
>7ckq Chain F (length=272) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVRMYLKEIGRVNLLSAKEEIAYAQKIEEGDEESKRRLAEANLRLVVSI
AKRYVGRGMLFLDLIQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAIT
RAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGREPTPEEIAEDMDLT
PEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEATSPSDHAAYELL
KEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQI
EAKALRKLRHPSRSKRLKDFLE
Ligand information
>7ckq Chain 1 (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gttgactctcccctaggaggaggtcttataatgggagctgtcacggatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ckq The bacterial multidrug resistance regulator BmrR distorts promoter DNA to activate transcription.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		V102 L106 A141 R144 L145 S148 F178 R181 K185 T188 Y189 T191 W192 W193 Q196 R200 R210 P212 H214 T342 E344 R345 Q348
Binding residue
(residue number reindexed from 1)		V3 L7 A42 R45 L46 S49 F79 R82 K86 T89 Y90 T92 W93 W94 Q97 R101 R111 P113 H115 T243 E245 R246 Q249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ckq, PDBe:7ckq, PDBj:7ckq
PDBsum7ckq
PubMed33293519
UniProtP06224|SIGA_BACSU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]