Structure of PDB 7cfd Chain F Binding Site BS01

Receptor Information
>7cfd Chain F (length=182) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHFEIGSIVGILITFINGPTEVYGQFLDGSPPLVWDKKDVPENKRTFKSK
PRLLDIVLALYSDGCFYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCLAPC
ENVDSFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHL
VQRLPDGFLIRFLDDWKYIPEQLLQRNYAQVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cfd Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution2.704 Å
Binding residue
(original residue number in PDB)		P595 V597 Y624 Y630 Y646 Y649 N651 N706
Binding residue
(residue number reindexed from 1)		P32 V34 Y61 Y67 Y83 Y86 N88 N143
Enzymatic activity
Enzyme Commision number ?
External links