Structure of PDB 7blo Chain F Binding Site BS01

Receptor Information
>7blo Chain F (length=294) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFK
QPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSY
DFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATY
PDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHM
ELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDP
TPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7blo Architecture and mechanism of metazoan retromer:SNX3 tubular coat assembly.
Resolution9.5 Å
Binding residue
(original residue number in PDB)		M166 E167 V168 G169 I170 R284 R285 F287 K288
Binding residue
(residue number reindexed from 1)		M159 E160 V161 G162 I163 R277 R278 F280 K281
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016241 regulation of macroautophagy
GO:0032456 endocytic recycling
GO:0042147 retrograde transport, endosome to Golgi
Cellular Component
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005768 endosome
GO:0005769 early endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex
GO:0031982 vesicle
GO:0097422 tubular endosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7blo, PDBe:7blo, PDBj:7blo
PDBsum7blo
PubMed33762348
UniProtO75436|VP26A_HUMAN Vacuolar protein sorting-associated protein 26A (Gene Name=VPS26A)

[Back to BioLiP]