Structure of PDB 7b1h Chain F Binding Site BS01

Receptor Information
>7b1h Chain F (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTE
NQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRR
QDSIPAFLSSLTLELFSRQTVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b1h Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S610 L613 K614 R617 V621 K625 F629
Binding residue
(residue number reindexed from 1)		S14 L17 K18 R21 V25 K29 F33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling

View graph for
Biological Process
External links
PDB RCSB:7b1h, PDBe:7b1h, PDBj:7b1h
PDBsum7b1h
PubMed34013668
UniProtQ9Y6D9|MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 (Gene Name=MAD1L1)

[Back to BioLiP]