Structure of PDB 7ad3 Chain F Binding Site BS01

Receptor Information
>7ad3 Chain F (length=318) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILS
ASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCT
IYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDI
PKAKRVREYSDHLGDVLALAIPEESNTFASCGSDGYTYIWDSRSPSAVQS
FYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSQGVVSL
DFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLA
VCTGSWDSTMKIWSPGYQ
Ligand information
>7ad3 Chain G (length=23) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RITASNACLTIINYTSNTKDYTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ad3 Structure of the class D GPCR Ste2 dimer coupled to two G proteins.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		I60 A63 L65 M68 L75 N81 D281 S284 D298 S301 I305 S360 G361 R362 L379 Y422
Binding residue
(residue number reindexed from 1)		I1 A4 L6 M9 L16 N22 D216 S219 D233 S236 I240 S255 G256 R257 L274 Y317
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030159 signaling receptor complex adaptor activity
GO:0031267 small GTPase binding
GO:0031682 G-protein gamma-subunit binding
GO:0097110 scaffold protein binding
Biological Process
GO:0000749 response to pheromone triggering conjugation with cellular fusion
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0001403 invasive growth in response to glucose limitation
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0010969 regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0019236 response to pheromone
GO:0043577 chemotropism
GO:0061951 establishment of protein localization to plasma membrane
GO:1903260 protein localization to mating projection tip
Cellular Component
GO:0005737 cytoplasm
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0005937 mating projection
GO:0005938 cell cortex
GO:0031680 G-protein beta/gamma-subunit complex
GO:0120171 Cdc24p-Far1p-Gbetagamma complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ad3, PDBe:7ad3, PDBj:7ad3
PDBsum7ad3
PubMed33268889
UniProtP18851|GBB_YEAST Guanine nucleotide-binding protein subunit beta (Gene Name=STE4)

[Back to BioLiP]