Structure of PDB 7abh Chain F Binding Site BS01

Receptor Information

>7abh Chain F (length=75) Species: 9606 (Homo sapiens)

SSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGS
YLAHTQGKKHQTNLARRAAKEAKEA

Ligand information

>7abh Chain 2 (length=37)

aaguguaguaucuguucuuaucaguuuaauaucugau

...................<<<<<........>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7abh Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
• Resolution: 4.5 Å
• Binding residue (original residue number in PDB): T61 L62 G75
• Binding residue (residue number reindexed from 1): T43 L44 G57

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0010976 positive regulation of neuron projection development
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0071004 U2-type prespliceosome
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7abh, PDBe:7abh, PDBj:7abh
• PDBsum: 7abh
• PubMed: 33243851
• UniProt: Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Gene Name=SF3A2)