Structure of PDB 6ygj Chain F Binding Site BS01

Receptor Information
>6ygj Chain F (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYK
NVVGARRSSWRVISSIEQKNEKKQQMGKEYREKIEAELQDICNDVLELLD
KYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEA
FEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAE
LDTLNEESYKDSTLIMQLLRDNLTLWTS
Ligand information
>6ygj Chain I (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKIRLNNAIWRAWYIQYVQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ygj Structure-based evolution of a promiscuous inhibitor to a selective stabilizer of protein-protein interactions.
Resolution2.07 Å
Binding residue
(original residue number in PDB)		R58 S59 R62 S66 Y181 E182 K214 T217 L218 L222 D225 N226
Binding residue
(residue number reindexed from 1)		R57 S58 R61 S65 Y177 E178 K210 T213 L214 L218 D221 N222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0045296 cadherin binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0043085 positive regulation of catalytic activity
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ygj, PDBe:6ygj, PDBj:6ygj
PDBsum6ygj
PubMed32770072
UniProtP31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)

[Back to BioLiP]