Structure of PDB 6xxs Chain F Binding Site BS01

Receptor Information
>6xxs Chain F (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLYLRPGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHK
TVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNL
REGNIMAVMATAMYLQMEHVVDTCRKFIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xxs Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
R40 Q42
Binding residue
(residue number reindexed from 1)
R43 Q45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xxs, PDBe:6xxs, PDBj:6xxs
PDBsum6xxs
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]