Structure of PDB 6vvt Chain F Binding Site BS01

Receptor Information

>6vvt Chain F (length=303) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLP
VQQRRDMQWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEG
NLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVE
VINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLD
QTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGV
VRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLR
DYL

Ligand information

>6vvt Chain O (length=31)

gcttgacaaaagtgttaaattgtgctatact

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6vvt The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
• Resolution: 2.901 Å
• Binding residue (original residue number in PDB): L178 N237 R239 L240 R268 K272 F273 D274 K277 Y279 K280 S282 T283 Y284 T286 W287 W288 Q291 R295 R305 P307 H309 T437 R440 Q443
• Binding residue (residue number reindexed from 1): L16 N75 R77 L78 R106 K110 F111 D112 K115 Y117 K118 S120 T121 Y122 T124 W125 W126 Q129 R133 R143 P145 H147 T275 R278 Q281

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6vvt, PDBe:6vvt, PDBj:6vvt
• PDBsum: 6vvt
• PubMed: 33199626
• UniProt: A0QW02