Structure of PDB 6vi1 Chain F Binding Site BS01

Receptor Information
>6vi1 Chain F (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFNFYSSYIHWVRQAPGKGLEWVAS
ISPYSGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYS
WPWVSYKPYYGLHFSAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSG
GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
>6vi1 Chain O (length=23) Species: 10754 (Lederbergvirus P22) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MELDAILDNLSDEEQIELLELLE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vi1 Recognition of an alpha-helical hairpin in P22 large terminase by a synthetic antibody fragment.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y252 W320 P321 W322 V323 S324 Y325 L331
Binding residue
(residue number reindexed from 1)		Y33 W101 P102 W103 V104 S105 Y106 L112
External links