Structure of PDB 6v92 Chain F Binding Site BS01

Receptor Information
>6v92 Chain F (length=67) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEILWFRGPSVIVNERIINSGDPHLSLPLNRWFTLEPDVENEKESLPGPF
VLGLRPSAKFTAHRLSM
Ligand information
>6v92 Chain 2 (length=28) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v92 Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
Resolution20.0 Å
Binding residue
(original residue number in PDB)		E788 I789 L790 W791 F792 R793
Binding residue
(residue number reindexed from 1)		E2 I3 L4 W5 F6 R7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006276 plasmid maintenance
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006325 chromatin organization
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006366 transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0007059 chromosome segregation
GO:0007062 sister chromatid cohesion
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0042173 regulation of sporulation resulting in formation of a cellular spore
GO:0070914 UV-damage excision repair
Cellular Component
GO:0005634 nucleus
GO:0016586 RSC-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v92, PDBe:6v92, PDBj:6v92
PDBsum6v92
PubMed31886770
UniProtQ06488|RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 (Gene Name=RSC2)

[Back to BioLiP]