Structure of PDB 6uph Chain F Binding Site BS01

Receptor Information
>6uph Chain F (length=79) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYT
EHAKRKTVTSLDVVYALKRQGRTLYGFGG
Ligand information
>6uph Chain I (length=119) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacgcgctgtcccccgcgttttaaccgccaaggggattactccctag
tctccaggcacgtgtcaga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uph Cryoelectron Microscopy Structure of a Yeast Centromeric Nucleosome at 2.7 angstrom Resolution.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R36 R46 I47 G49 K80 T81
Binding residue
(residue number reindexed from 1)
R12 R22 I23 G25 K56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6uph, PDBe:6uph, PDBj:6uph
PDBsum6uph
PubMed32004465
UniProtQ6CMU6

[Back to BioLiP]