Structure of PDB 6u3o Chain F Binding Site BS01

Receptor Information
>6u3o Chain F (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILV
MLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Ligand information
>6u3o Chain I (length=13) Species: 287 (Pseudomonas aeruginosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVVQSELPYPEGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u3o T cell receptor cross-reactivity between gliadin and bacterial peptides in celiac disease.
Resolution2.743 Å
Binding residue
(original residue number in PDB)		F11 S28 A57 W61 I67 K71 R77 V78 H81 N82
Binding residue
(residue number reindexed from 1)		F9 S26 A55 W59 I65 K69 R75 V76 H79 N80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6u3o, PDBe:6u3o, PDBj:6u3o
PDBsum6u3o
PubMed31873306
UniProtO19712

[Back to BioLiP]