Structure of PDB 6s1c Chain F Binding Site BS01

Receptor Information
>6s1c Chain F (length=299) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SINLHSAPEYDPSYKLIQLTPELLDIIQDPVQNHQLRFKSLDKDKSEVVL
CSHDKTWVLKQRKHSNTVLLMREFVPEQPITFDETLLFGLSKPYMDVVGF
AKTESEFETRETHGELNLNSVIGTLEELLENSPCSALEGISKWHKIGGSC
ILSQDFLFKALHVLLMSAMAESLLRIPFIAQWYGIQALRKYVSGISMPID
EFLIKWKSLFPPFFPCDIDIDMLRGYHFKKTVQYIAKSTLPMDPKERFKV
LFRLQSQWDLEDIKPLIEELNSRGMKIDSFIMKYARRKRLGKKTVVTSR
Ligand information
>6s1c Chain H (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s1c Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
Resolution6.1 Å
Binding residue
(original residue number in PDB)		P13 K16 K44 L60 K61 Q62 R63 S66 N67 F108
Binding residue
(residue number reindexed from 1)		P12 K15 K43 L59 K60 Q61 R62 S65 N66 F107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034088 maintenance of mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s1c, PDBe:6s1c, PDBj:6s1c
PDBsum6s1c
PubMed32585006
UniProtP25559|DCC1_YEAST Sister chromatid cohesion protein DCC1 (Gene Name=DCC1)

[Back to BioLiP]