Structure of PDB 6p0u Chain F Binding Site BS01

Receptor Information
>6p0u Chain F (length=51) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
D
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p0u Cooperative DNA binding by proteins through DNA shape complementarity.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R26 E40 Y41
Binding residue
(residue number reindexed from 1)		R26 E40 Y41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p0u, PDBe:6p0u, PDBj:6p0u
PDBsum6p0u
PubMed31616952
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]