Structure of PDB 6o1k Chain F Binding Site BS01

Receptor Information
>6o1k Chain F (length=65) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPSRPVRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o1k Architectural principles for Hfq/Crc-mediated regulation of gene expression
Resolution3.13 Å
Binding residue
(original residue number in PDB)		Y25 G29 I30 K31 L32 Q33 N48 Q52 T61
Binding residue
(residue number reindexed from 1)		Y20 G24 I25 K26 L27 Q28 N43 Q47 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o1k, PDBe:6o1k, PDBj:6o1k
PDBsum6o1k
PubMed30758287
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]