Structure of PDB 6n60 Chain F Binding Site BS01

Receptor Information
>6n60 Chain F (length=318) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITY
LPKQFDYVNSMTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAK
KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRS
IADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPED
KIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRA
ATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEA
KALRKLRHPSRSEVLRSF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n60 Structural mechanism of transcription inhibition by lasso peptides microcin J25 and capistruin.
Resolution3.68 Å
Binding residue
(original residue number in PDB)		L110 R385 S389 K418 F419 R423 Y425 K426 S428 T429 Y430 T432 W433 W434 R436 Q437 R441 R451 P453 H455
Binding residue
(residue number reindexed from 1)		L17 R93 S97 K126 F127 R131 Y133 K134 S136 T137 Y138 T140 W141 W142 R144 Q145 R149 R159 P161 H163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n60, PDBe:6n60, PDBj:6n60
PDBsum6n60
PubMed30626643
UniProtQ0P6L9

[Back to BioLiP]