Structure of PDB 6mi7 Chain F Binding Site BS01

Receptor Information
>6mi7 Chain F (length=217) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSL
LGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKA
AMILAVFTAIVAAVNVMWAGPWSSRHQDEVLARAELNWRITLVFTVFMMA
LMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSLKSNDPTLWMWTVNL
IYLALAIVLNLWDTVPV
Ligand information
>6mi7 Chain C (length=24) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MSKARRWVIIVLSLAVLVMIGINM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mi7 Structural basis of lipopolysaccharide extraction by the LptB2FGC complex.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Q293 P301 L304 L305 L308 L311 I312 S315
Binding residue
(residue number reindexed from 1)		Q163 P171 L174 L175 L178 L181 I182 S185
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0015920 lipopolysaccharide transport
GO:0043165 Gram-negative-bacterium-type cell outer membrane assembly
GO:0055085 transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:1990351 transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mi7, PDBe:6mi7, PDBj:6mi7
PDBsum6mi7
PubMed30894744
UniProtP0AF98|LPTF_ECOLI Lipopolysaccharide export system permease protein LptF (Gene Name=lptF)

[Back to BioLiP]