Structure of PDB 6lb3 Chain F Binding Site BS01

Receptor Information
>6lb3 Chain F (length=93) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADM
AIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lb3 Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa
Resolution2.497 Å
Binding residue
(original residue number in PDB)		R49 G50 S52
Binding residue
(residue number reindexed from 1)		R44 G45 S47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6lb3, PDBe:6lb3, PDBj:6lb3
PDBsum6lb3
PubMed
UniProtQ9HVC1

[Back to BioLiP]