Structure of PDB 6l9h Chain F Binding Site BS01

Receptor Information
>6l9h Chain F (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6l9h Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttagggttagggttagggttagggttagggttagggttagggttagg
gttagggttagggttagggttagggttagggttagggttagggttagggt
tagggttagggttagggttagggttagggttagggttagggtgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l9h The human telomeric nucleosome displays distinct structural and dynamic properties.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R45 I46 S47 R78 K79 T80
Binding residue
(residue number reindexed from 1)
R21 I22 S23 R54 K55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6l9h, PDBe:6l9h, PDBj:6l9h
PDBsum6l9h
PubMed
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]