Structure of PDB 6kop Chain F Binding Site BS01

Receptor Information
>6kop Chain F (length=159) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFR
SFRHGTNLKAWLYRILTNTYINSYRKKQRQPSTGLRSAEVEALEALPDTE
IKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQ
LRGLLADVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kop RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.
Resolution3.303 Å
Binding residue
(original residue number in PDB)
D38 G42 R46 T76 K79 A80 W81 Y83 R84 N88
Binding residue
(residue number reindexed from 1)
D18 G22 R26 T56 K59 A60 W61 Y63 R64 N68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0006979 response to oxidative stress
GO:0009408 response to heat
GO:0034605 cellular response to heat
GO:0051409 response to nitrosative stress
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6kop, PDBe:6kop, PDBj:6kop
PDBsum6kop
PubMed32127479
UniProtP9WGH9|SIGH_MYCTU ECF RNA polymerase sigma factor SigH (Gene Name=sigH)

[Back to BioLiP]