Structure of PDB 6kon Chain F Binding Site BS01

Receptor Information
>6kon Chain F (length=180) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFR
SFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEH
SSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIA
EIMDTPIGTVMSRLHRGRRQLRGLLADVAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kon RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q39 L45 R46 R49 K64 S71 R73 T76 N77 A80 W81 Y83 R84 I85 N88
Binding residue
(residue number reindexed from 1)		Q19 L25 R26 R29 K44 S51 R53 T56 N57 A60 W61 Y63 R64 I65 N68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0006979 response to oxidative stress
GO:0009408 response to heat
GO:0034605 cellular response to heat
GO:0051409 response to nitrosative stress
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kon, PDBe:6kon, PDBj:6kon
PDBsum6kon
PubMed32127479
UniProtP9WGH9|SIGH_MYCTU ECF RNA polymerase sigma factor SigH (Gene Name=sigH)

[Back to BioLiP]