Structure of PDB 6k0b Chain F Binding Site BS01

Receptor Information
>6k0b Chain F (length=95) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITPHNILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGR
EVVIPKDIAVFLFQLKGCKVKVDGRLLIGRPEERLKKKIKILYPY
Ligand information
>6k0b Chain V (length=83) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggugggguucccgagcggccaaagggagcagacucuaaaucugccgucau
cgacuucgaagguucgaauccuucccccaccac
<<<<<<<..<<<...........>>>.<<<<<.......>>>>>.<<<..
.>>>...<<<<<.......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		K86 K87 K88
Binding residue
(residue number reindexed from 1)		K86 K87 K88
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004526 ribonuclease P activity
GO:0033204 ribonuclease P RNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtQ57903|RNP1_METJA Ribonuclease P protein component 1 (Gene Name=rnp1)

[Back to BioLiP]