Structure of PDB 6jbq Chain F Binding Site BS01

Receptor Information
>6jbq Chain F (length=186) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAF
IKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAE
NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGL
SYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQPLIR
Ligand information
>6jbq Chain G (length=48) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgcatccgtgagtcgagggtgttcaataattagcactaaaagttccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jbq Structures and mechanism of transcription initiation by bacterial ECF factors.
Resolution4.02 Å
Binding residue
(original residue number in PDB)
N80 K83 N84 E102 F106 R149 S155 Y156 R171 F175 R178
Binding residue
(residue number reindexed from 1)
N76 K79 N80 E98 F102 R145 S151 Y152 R167 F171 R174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006970 response to osmotic stress
GO:0009266 response to temperature stimulus
GO:0036460 cellular response to cell envelope stress
GO:0045892 negative regulation of DNA-templated transcription
GO:0090605 submerged biofilm formation
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6jbq, PDBe:6jbq, PDBj:6jbq
PDBsum6jbq
PubMed31131408
UniProtP0AGB6|RPOE_ECOLI ECF RNA polymerase sigma-E factor (Gene Name=rpoE)

[Back to BioLiP]