Structure of PDB 6j6q Chain F Binding Site BS01

Receptor Information
>6j6q Chain F (length=161) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNYLEKRLAKIQQEQEDDEELENLRKKNLEMSQRAEMI
NRSKHAQQEKA
Ligand information
>6j6q Chain B (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaucuagaaagguaugucuaaaguuacuuaugcucuuauuuacuaaca
aaaucaa
..................................................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j6q Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		E3 R4 K26
Binding residue
(residue number reindexed from 1)		E2 R3 K25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
GO:0030620 U2 snRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6q, PDBe:6j6q, PDBj:6j6q
PDBsum6j6q
PubMed30879786
UniProtP28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)

[Back to BioLiP]