Structure of PDB 6j4f Chain F Binding Site BS01

Receptor Information
>6j4f Chain F (length=63) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APAEDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSREGHITE
IIYKGAHNHLKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j4f Crystal structure of the AtWRKY2 domain
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R279 K280
Binding residue
(residue number reindexed from 1)
R10 K11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6j4f, PDBe:6j4f, PDBj:6j4f
PDBsum6j4f
PubMed
UniProtQ9FG77|WRKY2_ARATH Probable WRKY transcription factor 2 (Gene Name=WRKY2)

[Back to BioLiP]