Structure of PDB 6iy3 Chain F Binding Site BS01

Receptor Information
>6iy3 Chain F (length=88) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN
VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6iy3 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgcaacagtcctaacattcacctcttgtgtgtttgtgtctgttcgcc
atcccgtctccgctcgtcacttatccttcactttccagagggtccccccg
cagaccccggcgaccctcaggtcggccgactgcggcacagttttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iy3 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		R45 I46 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R31 I32 R64 K65 T66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6iy3, PDBe:6iy3, PDBj:6iy3
PDBsum6iy3
PubMed30867599
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]