Structure of PDB 6ifn Chain F Binding Site BS01

Receptor Information
>6ifn Chain F (length=220) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTFAKIKFSAQIRLETGLHIGGSDAFAAIGAIDSPVIKDPITNLPIIPGS
SLKGKMRTLLAKVYNEKVAEKPSDDSDILSRLFGNSKDKRFKMGRLIFRD
AFLSNADELDSLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFE
LIYEITDENENQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFENLKA
TTVFGNYDVKTLNELLTAEV
Ligand information
>6ifn Chain N (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuacc
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifn Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution2.9 Å
Binding residue
(original residue number in PDB)		I20 G21 G22 S50 S51 K53 G54 K55 R57 S86 K92 F122 E123 N124 T125 I126 A133 P135 R136 Y181 G183 G184 S187 R188
Binding residue
(residue number reindexed from 1)		I20 G21 G22 S50 S51 K53 G54 K55 R57 S86 K92 F122 E123 N124 T125 I126 A133 P135 R136 Y181 G183 G184 S187 R188
External links