Structure of PDB 6ib1 Chain F Binding Site BS01

Receptor Information
>6ib1 Chain F (length=55) Species: 204090 (Staphylococcus phage P68) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYEGNNMRSMMGTSYEDSRLNKRTELNENMSIDTNKSEDSYGVQIHSLSK
QSFTG
Ligand information
>6ib1 Chain G (length=27) Species: 204090 (Staphylococcus phage P68) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MYEGNNMRSMMGTSYEDSRLNKRTELN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ib1 Structure and genome ejection mechanism ofStaphylococcus aureusphage P68.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T54 G55
Binding residue
(residue number reindexed from 1)		T54 G55
Enzymatic activity
Enzyme Commision number ?
External links