Structure of PDB 6hqu Chain F Binding Site BS01

Receptor Information

>6hqu Chain F (length=204) Species: 186497 (Pyrococcus furiosus DSM 3638)

ATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQL
PPEEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAQM
QLLYQASAMMVESLNTDRPYKLLIVDSLTRQQKLARFLRMLHRLANEFDI
AVFVTNQVQANGGHILAHSATLRVYLRKGKGGKRIARLIDGEAVFSITEK
GIED

Ligand information

>6hqu Chain N (length=12) Species: 9606 (Homo sapiens)

KLNVGFSTASGK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6hqu Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.
• Resolution: 1.97 Å
• Binding residue (original residue number in PDB): L197 V200 A201 Y202 A203 A220 M221 E224 Y232
• Binding residue (residue number reindexed from 1): L90 V93 A94 Y95 A96 A108 M109 E112 Y120

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 02:50:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6hqu', asym_id = 'F', bs = 'BS01', title = 'Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6hqu', asym_id='F', bs='BS01', title='Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot = '', pdbid = '6hqu', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot='', pdbid='6hqu', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>