Structure of PDB 6he5 Chain F Binding Site BS01

Receptor Information
>6he5 Chain F (length=242) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMGYDRAITVFSPDGRLFQVEYAREAVKRGATAIGIKCKEGVILIADKRV
GSKLLEADTIEKIYKIDEHICAATSGLVADARVLIDRARIEAQINRLTYD
EPITVKELAKKICDFKQQYTQYGGVRPFGVSLLIAGVDEVPKLYETDPSG
ALLEYKATAIGMGRNAVTEFFEKEYRDDLSFDDAMVLGLVAMGLSIESEL
VPENIEVGYVKVDDRTFKEVSPEELKPYVERANERIRELLKK
Ligand information
>6he5 Chain M (length=9) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PDLKGVMFV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6he5 Cryo-EM structures of the archaeal PAN-proteasome reveal an around-the-ring ATPase cycle.
Resolution4.12 Å
Binding residue
(original residue number in PDB)
R33 K66 G80 L81
Binding residue
(residue number reindexed from 1)
R29 K62 G76 L77
Enzymatic activity
Enzyme Commision number 3.4.25.1: proteasome endopeptidase complex.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
GO:0005515 protein binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0010498 proteasomal protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005737 cytoplasm
GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6he5, PDBe:6he5, PDBj:6he5
PDBsum6he5
PubMed30559193
UniProtO29760|PSA_ARCFU Proteasome subunit alpha (Gene Name=psmA)

[Back to BioLiP]