Structure of PDB 6fq6 Chain F Binding Site BS01

Receptor Information
>6fq6 Chain F (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>6fq6 Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fq6 Structural rearrangements of the histone octamer translocate DNA.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R35 R39 I46 S47 G48 Y51 K79 T80
Binding residue
(residue number reindexed from 1)		R16 R20 I27 S28 G29 Y32 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6fq6, PDBe:6fq6, PDBj:6fq6
PDBsum6fq6
PubMed29626188
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]