Structure of PDB 6eec Chain F Binding Site BS01

Receptor Information
>6eec Chain F (length=319) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLY
ATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAK
RYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRA
MADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPE
KVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQD
QLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIES
KTMSKLRHPSRSQVLRDYL
Ligand information
>6eec Chain O (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgaacctggtcttgactccattgccggatttgtattagactggcagggtt
gccccgaagcgggcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6eec Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
Resolution3.55 Å
Binding residue
(original residue number in PDB)		D226 V228 R229 L232 G236 L240 N299 R301 L302 S305 K334 D336 K339 Y341 K342 T345 Y346 W349 W350 Q353 R367 P369 H371 R470 V498 T499 E501 R502 Q505
Binding residue
(residue number reindexed from 1)		D18 V20 R21 L24 G28 L32 N91 R93 L94 S97 K126 D128 K131 Y133 K134 T137 Y138 W141 W142 Q145 R159 P161 H163 R262 V290 T291 E293 R294 Q297
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eec, PDBe:6eec, PDBj:6eec
PDBsum6eec
PubMed30626968
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]