Structure of PDB 6edt Chain F Binding Site BS01

Receptor Information
>6edt Chain F (length=322) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEA
GLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVS
LAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAI
TRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDI
TPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTL
LQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQ
IESKTMSKLRHPSRSQVLRDYL
Ligand information
>6edt Chain O (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgaacctggtcttgactccattgccggatttgtattagactggcagggtt
gccccgaagcgggcg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6edt Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
ResolutionN/A
Binding residue
(original residue number in PDB)		D226 V228 L232 G236 L240 N299 R301 L302 S305 K308 R330 K334 D336 K339 Y341 K342 S344 T345 Y346 W350 Q353 R367 H371 R470 V498 T499 E501 R502 Q505
Binding residue
(residue number reindexed from 1)		D21 V23 L27 G31 L35 N94 R96 L97 S100 K103 R125 K129 D131 K134 Y136 K137 S139 T140 Y141 W145 Q148 R162 H166 R265 V293 T294 E296 R297 Q300
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009415 response to water
GO:0010468 regulation of gene expression
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6edt, PDBe:6edt, PDBj:6edt
PDBsum6edt
PubMed30626968
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]